DPCstruct | MC5464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 155 ± 8 aa |
| Standard deviation of domain lengths | 8.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A099L6Z6 | 3-147 | LELKNRAIEADQVHSEILDRCCEWDNIVERSDDLVKFLDLDIGEESKTLIRRLIDTNLALNLTHAELEAKRDKSVLEYALAKLGGNL… |
| A0A0S2TIE5 | 50-213 | MPREPSRLPGRISRTWLRPYADRCRALMQARAIYDVLYSAAIDMERSMPNERLALFDRMWFSRIDAGSLASVRQAWRRVDTDLERWE… |
| A0A5C6QIU2 | 118-272 | None |
| A0A496X5F0 | 213-354 | None |
| A0A496WWZ3 | 80-242 | None |
| A0A846LBR0 | 12-171 | None |
| A0A5C1ANS1 | 1-161 | None |
| A0A848Z5C7 | 2-145 | None |
| A0A1S7RH69 | 101-258 | None |
| A0A2T6NIT0 | 277-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.