DPCstruct | MC54637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 288 ± 29 aa |
| Standard deviation of domain lengths | 29.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655AQ98 | 1-300 | MLVLHGFWSNSGGMRLWAEDSDLLVKSPSQALRSARPHPFAAPADLIAGIHPGKPATAVLLLPSLRSAPLDSPELIRLAPRPAARTD… |
| A0A6V8LJB3 | 1-286 | MLVVHGFWSHAGRLALWAEDSAAPVRSSRRAARPHPFAAPAEAVAAALGDHAAKGAHGWAALDLPTAGSRPLDSPELVRTDLPAKVT… |
| A0A284VIJ0 | 1-318 | None |
| D2Z6H0 | 1-239 | None |
| A0A1F4CQ80 | 1-306 | None |
| A0A2L0ETI1 | 22-271 | None |
| W7YPE3 | 4-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.