DPCstruct | MC54636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 212 ± 34 aa |
| Standard deviation of domain lengths | 34.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655AMZ8 | 5-182 | DPAGIQGALDGVYDRVDGEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDDDRRPLRNTREA… |
| A0A1F7MKP3 | 2-233 | TQEPFQPVRLYYAIPDRAFVTAKLRGLKCTVESPAERCWQWLFHAEAASLRFAAGYDEVPKEKRPIVLGRLRFPKSGGMTLQTNSIL… |
| A0A7W4YYN8 | 17-242 | None |
| A0A1E4HWC9 | 178-397 | None |
| A0A849IK00 | 442-677 | None |
| A0A7V2XHM1 | 13-199 | None |
| A0A6N6Q2S3 | 5-226 | None |
| A0A5F1P879 | 3-137 | None |
| A0A7X1GPT6 | 143-388 | None |
| A0A7X8LPV4 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.