DPCstruct | MC54626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 10.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0016- PF06146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C2J7Q0 | 16-134 | RTGGTMVEIFKSLSLFIIGASIIWSATHFYVHLIHRGYATLQDLLLLFVYLEIGAMTGIYFKTGKLPVRFLIYVAVTAIARYLVVDV… |
| A0A0W1RSM1 | 5-133 | RLSHPIHNVVRSLELFGLVVILIATFIAAGQDVAEMIAARRVTLADLLLLFLYLEVLAMIGAYLQTGRLPIRYPIYIAIIALARYLV… |
| A0A1G7D9G3 | 1-132 | None |
| A0A562IL17 | 39-190 | None |
| A0A1I7Y439 | 186-314 | None |
| A0A3B0WH18 | 16-152 | None |
| A0A812XUZ5 | 437-551 | None |
| A0A5P2HHI3 | 1-110 | None |
| A0A1M5UT34 | 4-135 | None |
| J3EZV2 | 64-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.