DPCstruct | MC54621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6JEL7 | 13-139 | ELEEWGTEAQVKLGSRLIELLLDSAFVQPAADQTPDSSPDIRPAFKHVLRQPIIENGRLKKKHWVIECDHLVHEGFESSAWHVDIPN… |
| S4RK49 | 356-465 | EWTLPVTVTLGSYLLDIMVRELKVYSGTGSTDLVRGTKPIPALYHVYAFRSVRQIGFVKPHPLVTQLQSRAVETELHFDVQALPTSC… |
| A0A183KQW7 | 163-309 | None |
| A0A4Z2DVV8 | 293-428 | None |
| H2Y3Q0 | 79-209 | None |
| A0A4P9WFV7 | 1-141 | None |
| A0A0R3U9V8 | 502-632 | None |
| A0A183QZQ7 | 159-299 | None |
| A0A821A418 | 168-301 | None |
| A0A6P6BMJ6 | 372-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.