DPCstruct | MC54617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 127 ± 27 aa |
| Standard deviation of domain lengths | 26.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10185 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EKI1 | 14-121 | ITLFQIDMSNPENLLKLSKKGRTLMVFVSVVGNPTRQETEQITQLWQTSLWNSHIQAERYLVDDDRAIFMFKDGSQAWDAKNFIVEQ… |
| A0A444SDR1 | 2-84 | MFVRTKEEFSPEEATAITQRWQTSLWNSHIQAERYMVDDKRAIFMFKDGSLAWEAKDFLIEQEELLECTLENRSYYGKYTPEI |
| A0A813FCU1 | 999-1129 | None |
| A0A7S3MFZ3 | 18-162 | None |
| A0A1V9ZD45 | 205-381 | None |
| R7T526 | 1-96 | None |
| A0A7R9LBH3 | 39-184 | None |
| A0A5B8N2F2 | 17-178 | None |
| A0A5N4DKH3 | 2-102 | None |
| A0A1S3ZNB3 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.