DPCstruct | MC54616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2BP73 | 318-482 | DLDCFVFECNDTMLGLAILSRYHVEDYVSMQSIHQDDYGRLLHFVLTPIFFAYHRFFFREIARLSGLTVIFYRLQHEDESALTRKRP… |
| A0A7S3QR29 | 123-274 | AVVASVQGEVVGLATVSTSVDLVMLKANFSLSHLVNLPDQMSSEHAEIDMVCLNPIFAHRARELLSGVHRILKKTVLYYALPPGQAI… |
| A0A2I0TA09 | 97-264 | None |
| A0A1Y1KGI0 | 303-474 | None |
| A0A3Q0CU67 | 1-158 | None |
| A0EGL6 | 282-461 | None |
| Q23F13 | 852-1036 | None |
| A0A7S3QR82 | 123-272 | None |
| A0A0W8DMU5 | 357-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.