DPCstruct | MC54615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 304 ± 48 aa |
| Standard deviation of domain lengths | 47.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.09 |
| Pfam Score | 92.28 |
| Assigned Pfam label(s) | CL0020- CL0105- PF21144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SGP4 | 1-249 | MTDDEVLQAHYERFQAFQLLSFKKIPKLKELALANIGSIHKRADLSKKLSVLSPDELRDLVCNKLKLISKSDPWTERVDFLIEVMVS… |
| A0A7R9EK25 | 5-302 | ADHLDLLDMLKFYSRFEISDETGDPLTDHDMTQIHYSRITSLQKAAFAKFPDLRSFSLANVASVDTRETLIKHFGPLSEQKLKAIAR… |
| A0A7N2KPM1 | 5-435 | None |
| A0A438DHE0 | 232-561 | None |
| A0A433DN50 | 14-289 | None |
| A0A7J6UC64 | 520-897 | None |
| A0A183WM03 | 17-227 | None |
| A0A6V7XCI8 | 190-508 | None |
| A0A1E4T619 | 224-461 | None |
| A0A6J5WAX7 | 17-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.