DPCstruct | MC54613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 33.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.77 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | CL0123- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EIJ7 | 29-256 | GVVRQREEGERDGGRLFEERPVWSKNALRYLTRFSNDQLKYLLPAVAYYFVTGPWRVMWVRFGYDPRTQPEARMYQTLDYRLRAKGG… |
| D8M462 | 173-359 | SKTPEGPRSTLPGIPEDSNLSYYLQSVRCLVENQPIWDKQYLVLRVAEMYPNEPKETVRNNVYLVVPYVCYVLTDGPFRNCWVRFGF… |
| I4Y7X9 | 152-390 | None |
| A0A1P8BB21 | 219-465 | None |
| A0A066VUT5 | 718-961 | None |
| A0A653BRS0 | 11-224 | None |
| H0EJ18 | 2-192 | None |
| A0A0V0R1V3 | 209-415 | None |
| A0A365MK19 | 295-500 | None |
| A0A6A5E172 | 50-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.