DPCstruct | MC54612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8JTF1 | 124-198 | FKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEQFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISD |
| A0A0L8FPF9 | 65-132 | FQNPIVGVHVRRTDKVGTEAAYHSLEEYMAHVEDYYRQLEMSKGHSIETKKVYLASDDPNVLADAVNK |
| A0A182VQX6 | 839-908 | None |
| A0A2T7NYL2 | 829-903 | None |
| A0A814IHM8 | 50-116 | None |
| A0A0M3K8I3 | 26-90 | None |
| A0A813TUJ9 | 610-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.