DPCstruct | MC54610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 294 ± 36 aa |
| Standard deviation of domain lengths | 36.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EEK2 | 38-346 | TTVSSEDITKRLGLDYMVEQRLIAEYSFFASSFYTPNHIETMVLKVLQWLSERATCTQLLVVQPLPLLLERLMSNAWAQINRTTGDV… |
| A0A480PSI5 | 236-524 | DGLMLQDLVSAKLISDYTVVEIPDSVNDLQGTTKVAQAVRWLVSRCPRALDLCSQTLIQYVEDGVSREFSSRFFHDRSERRRGGLAS… |
| A0A1B6BYU5 | 595-854 | None |
| U4UC42 | 2-248 | None |
| F1Q712 | 1587-1862 | None |
| S4R705 | 14-304 | None |
| A0A162SDE6 | 678-923 | None |
| A0A553PLZ7 | 1-269 | None |
| A0A182MT14 | 494-888 | None |
| Q9WUU9 | 1508-1790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.