DPCstruct | MC54607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EBZ3 | 16-143 | PKQKHAPFLSVIPRECPDNPLVEPWGVQNCTEDSECWPRICCPEGSTSYCRTSPPTFKLAPRLFPLKNAVAYLQCTTPPPPIFDLFP… |
| A0A834MMF0 | 135-268 | PRHEPLLFGIIQRKCPENPLAELSDIQECFTDDECSPRICCGETLQNGEKARYCRTPIPVWDTLPLPSPVLEPLKTLTGYMQCTPAP… |
| A0A1J1J0N0 | 176-324 | None |
| A8JQW5 | 281-424 | None |
| A0A1A9XMS4 | 44-166 | None |
| A0A482WST6 | 104-258 | None |
| A0A7R8ZBY1 | 176-317 | None |
| A0A7J7BCR0 | 335-481 | None |
| A0A6L2PMU4 | 81-193 | None |
| A0A7R9D414 | 61-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.