DPCstruct | MC54602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8LCG8 | 34-168 | ESLNLPTKANKEKEQQAAKAIAFPEAGELNKDTDLHQVASKALENYYASKSMQLVAFNIISDNWKVVTHKTTGAVLYQWAVGALIQK… |
| A0A2E4CUC9 | 202-325 | DQIEQQADANYAALVASTRMYDAVRSDPALERSFVQAYWASPFSRDYAGGKVLKVHLTSRAWSVQHDATGRPVSRDQGASMAIRAPD… |
| A0A1G7JX83 | 74-172 | None |
| A0A351AQR9 | 298-422 | None |
| A0A353VSX2 | 70-188 | None |
| A0A7Y4XTL7 | 91-213 | None |
| A0A1G7BAZ4 | 279-407 | None |
| A0A7K3NEF9 | 282-405 | None |
| A0A7Y4TSZ9 | 480-593 | None |
| A0A150Q8U5 | 23-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.