DPCstruct | MC546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6AJV7 | 167-234 | LVRKEARLTEGQLDDLTLLVRKLNRTRRGKGERITENTLIRLAVDLLLQRAEFLTGATEEDLRHSLGL |
| A0A7X1I7N1 | 1-68 | MERKEARLRADQVADLAALRRHVSARRRNRSEIITDNTLIRVAVDLLMAHAHRLRGDTEEDLRRSVLP |
| A0A429EPD2 | 5-79 | None |
| A0A220UH63 | 25-117 | None |
| A0A318S767 | 76-159 | None |
| A0A7W5A9I0 | 91-170 | None |
| A0A291T6H7 | 34-132 | None |
| A0A3R8NWH9 | 1-67 | None |
| A0A318S5B2 | 57-133 | None |
| A0A315TLW6 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.