DPCstruct | MC54598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0T1C3 | 4-83 | RVMNKYLYGEGHPYSNPSGTGYEETIENLTRDDVVKFYETWIKPNNATIVVPGDVEMKYLKSKLEKSLGKWKKADVPEMT |
| A0A2V9ZQ59 | 64-153 | PDRMAGQLLFATAYQRHPYRLPVIGLLDVFNQLTRDDVLQYYRARYVPNNLTFIVVGDVNADAVHQQLGDFFKNYPAKSLAPVFIPP… |
| A0A820RGZ6 | 13-94 | None |
| A0A4Y9JI27 | 7-85 | None |
| A0A376EU52 | 118-200 | None |
| A0A090QSL5 | 24-121 | None |
| A0A832AQA5 | 112-206 | None |
| A0A2N8FLG1 | 18-96 | None |
| A0A2V8UY92 | 3-100 | None |
| A0A7U0TT10 | 74-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.