DPCstruct | MC54591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 237 ± 29 aa |
| Standard deviation of domain lengths | 29.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02665 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C2FX67 | 10-255 | VLLYVAFTVLVGGVIYKIGIYAMTPAPLRIPTMPAPRTRSGVAVRLGREVVLFASLFRGDKWAWIWSYLFHVSLLLVLIQHLRYVLV… |
| A0A2M8AA60 | 81-300 | NSFLFISFPYLAFGIFILGTIYRYKNRGFQVSSLSTQFLEGKQLFWASQPFHWGMVIIFLGHLIAFLTPSAIIAWNGDSLRLLILEI… |
| A0A2T7YRG3 | 2-165 | None |
| A0A7X8R7I7 | 9-242 | None |
| D3EZU0 | 6-247 | None |
| A0A2D2C2Y0 | 2-234 | None |
| A0A3A4ZIB4 | 79-332 | None |
| A0A3A4Z1T4 | 437-694 | None |
| A0A3A4XMS7 | 3-228 | None |
| A0A655EF58 | 365-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.