DPCstruct | MC54590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815TMQ2 | 24-132 | YLKVFAIPIETVHLFRDIESARIAFNSNGSLFYNLRYFEQVYWDDLKPFLNGNCSSSIEIVRRLINFYYMVTCHELSHNIDSNHDLN… |
| A0A2P4PUA3 | 5-102 | LAEVFKLSPENIHIFYDNNSNTIAFNRDRILFFNLRFYLGLHDEECKTKPTTNAMTYWYMMFCHELSHNFVKNHNSQHEYYFLVLAE… |
| G2YWV7 | 403-512 | None |
| H0ECG9 | 1185-1268 | None |
| A0A815U5H9 | 106-219 | None |
| A0A815FG78 | 205-323 | None |
| A0A7S1PFV6 | 626-774 | None |
| A0A0G4MMT5 | 886-1002 | None |
| U7PIZ7 | 1790-1920 | None |
| U9SIW5 | 541-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.