DPCstruct | MC5459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 389 ± 49 aa |
| Standard deviation of domain lengths | 48.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2J9Y7 | 1-322 | MRPEQRSQKLLGVTRSKAKMYEYGVPEEHHISIPQDPAKLFSLTIGMLGDLAAAINREGIQPESIIELRDNLIFSARFFDSYLQSKL… |
| A0A397PKQ5 | 28-385 | ELLAAITQLEIAAFGRDQEISDDVLATAWLLHGLAAVEPETPGFDPMRTRQALAVSAHVMDLALADERHSPTERLRIAFAAQAGYRR… |
| A0A0U5PLK6 | 3-384 | None |
| A0A3E1NLK4 | 1-482 | None |
| A0A2D0HL12 | 277-629 | None |
| A0A3N0GIC2 | 9-324 | None |
| A0A2S0USL1 | 16-405 | None |
| G2FEB7 | 10-373 | None |
| A0A252DIP5 | 8-408 | None |
| X1WQ86 | 15-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.