DPCstruct | MC54587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 144 ± 43 aa |
| Standard deviation of domain lengths | 43.48 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5EQI5 | 138-311 | VLFTHSGISGPAALDISGFVAESLAAGPIELLLNCDQDSGREEWLHRFREWRKAHGARRVVNLLDMALPASFAEVVAETAGVNPARV… |
| W7U7K3 | 51-178 | ARLLALLDYQASFRIDWLPEFAYPDVVQRLQRAQTANARKHVGTYCPLLTTTAAGSVYVSRGKSIHKEEFTTAGGVALKEVDFKTFG… |
| A0A1Q9CLP0 | 413-597 | None |
| A0A7X6ZNE2 | 1-99 | None |
| A0A1X6PH73 | 360-576 | None |
| A0A7S1XIQ9 | 85-259 | None |
| A0A7C6WHJ9 | 17-127 | None |
| A0A317ZMI8 | 10-83 | None |
| A0A2H0FMZ5 | 91-274 | None |
| A0A0G0NMY4 | 59-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.