DPCstruct | MC54581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7SZS3 | 1-71 | MASFFGGIVGQEVLKACSGKFSPIKQWFYFDALECLPTEPVSEAEAAPLNCRYDGQIAVFGKSVQREANKG |
| A0A1V4J8H9 | 43-112 | NGFIGGVAAQEVMKAVSGKFTPIQQWLYFDALECLPEENREQLLTEETCRPRGNRYDGQVAVFGTGLQER |
| A0A812WCY1 | 1-68 | None |
| A0A1X7T0V5 | 595-685 | None |
| A0A453HRK3 | 83-149 | None |
| A0A3Q7RIU1 | 156-235 | None |
| A0A183DBV5 | 60-136 | None |
| A0A183DBS0 | 16-92 | None |
| A0A1S3MIZ4 | 53-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.