DPCstruct | MC5458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1LLX6 | 6-123 | AIIIKNPRLRKVRNELRKLFLKAVSREWNKLFDEKEKISKYKDGTVKSVKNMSASEEMHFRSLQNKQAKLRNISDKSICKCTTCGKA… |
| A0A524FAH6 | 1-102 | MKKRRKIILNNSQLKRIRNNLRIIILNAAYDKLGTLKAIWYPIDGEIALSLEGHKLYKKIQLLERAIDASICKCPICNHSDRDMIYI… |
| A0A842TDC5 | 22-133 | None |
| A0A0F9S3V9 | 23-150 | None |
| A0A0F9G720 | 1-91 | None |
| A0A532TT04 | 1-110 | None |
| A0A5C9E928 | 2-141 | None |
| A0A5C9DU59 | 2-105 | None |
| A0A0F9GY71 | 7-102 | None |
| A0A523VT79 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.