DPCstruct | MC54572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 227 |
|---|---|
| Mean domain length (aa) | 285 ± 75 aa |
| Standard deviation of domain lengths | 74.76 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 77.39 |
| Assigned Pfam label(s) | PF16350- CL0289- PF08170- CL0061- CL0740 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538LHD8 | 22-352 | EGWQWPNHFGDPVAEHEAVRNDVGVWDESPLRKWDFRGPDALRAADRIFTNDMLGLATGQIRYAPFCDADGKMVGDGTVFKFDDGHA… |
| A0A1F2VCM5 | 13-286 | QGNYNFVLDTHGHILADARIFRLDAESYLIDSEPQRIEIIRQALDHHIISDVVELEDWSARLACLALEGPCAREVLRETIGFDPPHM… |
| A0A437UXM7 | 151-391 | None |
| A0A812MUI1 | 135-466 | None |
| A0A7X7R7Q1 | 11-170 | None |
| A0A0D8XC31 | 1-177 | None |
| A0A7S2SSE3 | 4-338 | None |
| A0A194V5U4 | 483-832 | None |
| A0A7X0U4D0 | 521-858 | None |
| A0A7J0FX28 | 36-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.