DPCstruct | MC5457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MMJ5 | 2-171 | EASADAKLLANVQDQMTRLLSQLQDLDELRDELDDEEYEETKADTLEQLKEFEKSLKTMAAGKTTLMTDLSRMKLAVQAAISEAFKA… |
| A0A6P5D0D7 | 26-167 | GKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLIHLLQMDRDLMV… |
| D2VQ29 | 9-140 | None |
| A0A0V0R270 | 7-150 | None |
| A0A482WR24 | 65-232 | None |
| A0A091DKF1 | 161-331 | None |
| A0A6J1RY67 | 4-174 | None |
| A0A158P619 | 2-160 | None |
| A0A0M3JTB8 | 2-143 | None |
| A0A2A2LNT0 | 362-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.