DPCstruct | MC54569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2U0S4 | 9-174 | HALVGSGHPETKPPEGMDQQVYYGTIRNPVQTTHKSQYAPQMETSNFCKSCHTYVTPPDLKLTADWDIICTLTFDSWAAGPHGPTAT… |
| A0A7W1Z0N8 | 134-291 | VGCPQCHLIQDVDMNSHPPTPTFQLGTTIFGGYDKAAENLAHQSQKLELYRESKFCVTCHDSLPKTTGSAKDLPGWLGSWEKTKAET… |
| A0A7Y5N0T3 | 461-607 | None |
| A0A3M1AE55 | 121-293 | None |
| A0A4U1HT98 | 24-235 | None |
| A0A318CRH3 | 3-151 | None |
| A0A3C2AHK6 | 7-149 | None |
| A0A533YBF5 | 21-169 | None |
| A0A7Y3U6D5 | 134-279 | None |
| A0A7V4ZBD5 | 100-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.