DPCstruct | MC54564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07483 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0TGV5 | 89-216 | LNGDGTIGLAGTSIESSGAISLLQVGSNYFMVPAGGNSGPELMYQRSPVFSGEFGAWATIAAEAVSGGGYDIAWKNTASGQYLIWGV… |
| A0A0R3LG68 | 1-138 | MSGTDIESFGSTKLVQVGNNYYLASVSGNSGPELKCYGAPVVVGQFGAWTPIGTEQTASGYQVVLKYGTADSYIVWSVDSSGNYITN… |
| M4Z1I7 | 238-353 | None |
| A0A2N0GCW5 | 216-338 | None |
| A0A1H8W7X6 | 560-678 | None |
| A0A1H8JAQ0 | 810-953 | None |
| A0A1Z4UZA5 | 249-363 | None |
| A0A840GLK4 | 1-131 | None |
| A0A840GJR0 | 68-192 | None |
| A0A3S0H0S8 | 489-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.