DPCstruct | MC5456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 499 ± 31 aa |
| Standard deviation of domain lengths | 31.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5HUI7 | 1127-1624 | GDGISINMMSSPYFTTLKSVLKTDESIQTGEKKNVKFAAIDDLIVHDAPHPTDGYSNRSTQSDNFEMNQIWDLEKEVIRQLKRDNIT… |
| V9KJQ3 | 7-446 | ATETGKDLKSEQDSLSNTSHLETDQSVPVASQAVSTSPTEPEYCENRHEKPEIEVETSHTKISDRLIDACVNTDPVDFKESFKRLEV… |
| A0A2G5UQN3 | 735-1186 | None |
| E7EYR3 | 1183-1686 | None |
| A0A4U1F3H7 | 1-495 | None |
| A0A7J7F7C4 | 316-844 | None |
| A0A5F8G6N7 | 433-953 | None |
| A0A6A5HM25 | 297-804 | None |
| A0A672J290 | 10-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.