DPCstruct | MC54556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2TAW9 | 1-109 | MYSAGFLPFPTFKEQWACWSRHIWYSRYVDAPKGTYEKLLRLLDGEDLFILTTNVNHRFQLAGFPKERLFYTQGDYGLWQRSVPCYD… |
| A0A380DLA4 | 168-272 | YRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHIITTNADNAFDAAEYDMTHVFHIQGEYILQQCS… |
| A0A166PIQ7 | 540-655 | None |
| A0A7S1UKE1 | 365-474 | None |
| A0A1L9T4G6 | 798-902 | None |
| R5YVV1 | 4-81 | None |
| A0A542LJ15 | 70-163 | None |
| R7H4V2 | 1-96 | None |
| A0A3Q8SQV2 | 17-121 | None |
| A0A7G8H555 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.