DPCstruct | MC54548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8YVK4 | 1-122 | MQASPITPTISLILATPNSPKTSIISHNWCPLRCGSIRASSAPSTPTAPSPSTSTSDSSNKLNKHSSRITKPKSQGGSQAILYGVGL… |
| A0A427YTJ4 | 1-100 | MASSLAALRINLRQARPSVASRQLQTSAAAMNQPIMNRWSRTVTQPKSQGASQAMLYATDGIVEDDDFNKAMVGVASVWYEGNPCNK… |
| A0A1Q9DGX7 | 667-777 | None |
| A0A6A5P132 | 2-112 | None |
| A0A835U9M4 | 1-93 | None |
| A0A7N2R6J3 | 9-115 | None |
| A0A251SF95 | 1-119 | None |
| V5FVV3 | 1-101 | None |
| A0A2P6U5L0 | 1-113 | None |
| A0A401KYA4 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.