DPCstruct | MC54543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 519 ± 62 aa |
| Standard deviation of domain lengths | 62.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 93.45 |
| Assigned Pfam label(s) | CL0036- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427XPN8 | 2-479 | MFADDNYGNVVQVLDPDADHPAGAGLYYHADCHPWTWKWINNINLVKPFKADKIWVVNVGDLKNHELPLDHFLSLGYDFDRWGKRNG… |
| A0A1S8P8Z9 | 7-550 | IMLADDNFANVRTLPEEAERNRKAGWGMYYHFDYHGGPRSYEWVNTTPLEKVWEQMTMAYDYGVRDIWIVNIGDLKPNEFPVSYFLD… |
| A0A0J9WNU8 | 112-683 | None |
| R5URL3 | 2-523 | None |
| A0A5Q2TKC2 | 375-908 | None |
| A0A0U5CMD9 | 1-420 | None |
| T1W9F4 | 1-474 | None |
| A0A1F3EK94 | 2-419 | None |
| A0A175VX87 | 361-1014 | None |
| W4QI95 | 40-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.