DPCstruct | MC5454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF18423- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M1BCQ6 | 22-151 | VECPECGQKAKGVLGKTVEHLVTEETKAKLDCFDGFYYCKTPSCEVVYFRGDEILTQENMSVVVGCKEGASPATVCYCFEWSKEKIK… |
| A0A434AZ78 | 87-216 | CAKSGQLVPNTVFQSNLKTESLRKINLGTKNFICFNPDCKIAYYNEEIKIDLSELKRELWFKKGSKRKIICYCNNIDSEQIKEAILN… |
| A0A5Q0BJ89 | 9-126 | None |
| A0A7C3E481 | 2-117 | None |
| A0A2N2AB34 | 3-91 | None |
| A0A3M1T072 | 9-148 | None |
| A0A258R676 | 6-113 | None |
| A0A7X7U0I0 | 2-96 | None |
| A0A7C2SFW1 | 2-128 | None |
| A0A2E7KM56 | 26-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.