DPCstruct | MC54539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T8IV53 | 1-120 | MEYTISNNLISLCTKLRILQDTSEHEWNPDYSPEKEAFEEHENILFVIDGHVKDSIRECCNKIIHALSFELTKKTGKNGIKYWDGSI… |
| A0A454B3C2 | 1-103 | MLNIAVVVRNRLEVKKSACLKGYQDNVGTLEFVSSGETRELTFREACNKIIHSKRVTFLYETEPAYAGDPLKDNFIVRGQIGNKDWI… |
| A0A7C5QNT9 | 89-204 | None |
| A0A4R2UZW8 | 52-166 | None |
| A0A1F9VL80 | 6-99 | None |
| A0A1V3GWQ0 | 52-166 | None |
| A0A5N3P7E9 | 56-169 | None |
| A0A7W4FR51 | 10-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.