DPCstruct | MC54538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835FLS2 | 4-85 | LKLQKRLAASVLKCGKGKVWLDPNEVSEISMANSRQNIRKLVKDGFIIRKPQKIHSRSRARRAHEAKQKGRHSGYGKRRGTR |
| A0A814JLZ9 | 4-84 | LRVQKRLASSILRCGNKKIWLDPNEANEIANANTRQSVRKLIKDGLIIKKPVAVHSRFRTRKNNEARRKGRHMGHGKRKGT |
| A0A438N198 | 34-115 | None |
| A0A2C9WHQ7 | 1-91 | None |
| A0A497SH66 | 1-89 | None |
| R1GJL8 | 227-306 | None |
| A0A154PF53 | 2-77 | None |
| A0A821CCZ9 | 1-56 | None |
| A0A0F7S6T1 | 1-82 | None |
| A0A482UT11 | 2-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.