DPCstruct | MC54534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1ZQJ7 | 5-140 | NRPEIEQVDHETPDQRDELLARLKSSVPEAFSDGKLDVEALQALLGDNVADGPERFTLNWAGKRDAMAMLQAPSSATLAPDPDNSIN… |
| A0A4P8HAT7 | 18-132 | ELARLRAALPEFFDKDGGFMLDRLEETLRDGDVNLTREGYELKFLGKSYAKYLTSTKTETVVVPDVEHNSADANSDSQNLYIVGDNL… |
| A0A4V0ETM1 | 70-215 | None |
| A0A1T4PN64 | 11-146 | None |
| A0A1Q8JL77 | 9-132 | None |
| I7KN63 | 2-147 | None |
| A0A064A855 | 1-95 | None |
| A0A136K787 | 2-120 | None |
| A0A1X8V997 | 18-152 | None |
| A0A7T8AD95 | 10-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.