DPCstruct | MC5453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 212 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 15.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6ACM3 | 9-195 | ERLIGVSDVGFNNAKSHSEIKEKIISFGYDDVRLDELLDLNARTDGKYHDYERLYGEQLQATRRLEEKLYEEMGFYSTYRRLAFQVF… |
| A0A434AZ09 | 39-264 | DILESIPTKKIIKTCIPIGIYLQEAENLAQWCLTDIVPLSKLGVDREKLEDLQLRTKILRQTQTQWVQDKNSIPEDKKPWETIEKQL… |
| A0A355FEU1 | 10-225 | None |
| A0A2E9R4R2 | 21-263 | None |
| A0A2V8S994 | 1-209 | None |
| A0A1G0RDY6 | 5-213 | None |
| A0A2N1V1G7 | 4-218 | None |
| A0A1Z3HSY2 | 81-254 | None |
| A0A3D1QSZ0 | 7-237 | None |
| A0A368US76 | 4-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.