DPCstruct | MC54527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 258 ± 39 aa |
| Standard deviation of domain lengths | 38.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8KZH6 | 3-211 | IRLTMLDNAQDSLSRAIELLAWREISADTSRLKQAILGVAHASELLLKERLSRTNQALIWEDVDKFPNIDARTVTVDKAISRLRKIS… |
| A0A1C0VLQ1 | 1-282 | MNNEESNIKLELSLLDNGLDFILKGIDELFDDDYVIREYSSAIDIGMSSYKYGVLNLFSGFLLLLKERLARHLPELIFKGSIKDVKN… |
| A0A1M6V2B9 | 2-246 | None |
| A0A1H7D628 | 15-303 | None |
| A0A3D2H5H9 | 416-691 | None |
| A0A2N3VMT5 | 272-554 | None |
| A0A7V3E8M4 | 12-285 | None |
| N8P066 | 3-269 | None |
| A0A1J9X698 | 14-289 | None |
| A0A0C2MRJ3 | 101-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.