DPCstruct | MC54524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 99 ± 19 aa |
| Standard deviation of domain lengths | 19.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848FJD2 | 43-143 | LAGMAFWLAPPPREAAGMAAASAAAEPVKMAQVQTIVEQRCALCHNAQVQNKNVALHTPELIRSHAQAVYQQAVVQKSMPLNNATQI… |
| A0A1D8ATS6 | 5-92 | PPVQGEVTFNRVRAIVGQHCVACHSPSPTFPGITVPQAGVLLHTPADLVQNAPRVYQQVVVTRLMPLGNTTHMTDEERAVIAAWVKAG |
| A0A259Q6K1 | 22-127 | None |
| S9QN12 | 18-115 | None |
| A0A254TFK8 | 288-370 | None |
| A0A847BJ07 | 2-71 | None |
| A0A2U1AAI9 | 20-109 | None |
| A0A7R8L6R2 | 305-438 | None |
| A0A6L7KYB7 | 57-185 | None |
| A0A538LMW1 | 308-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.