DPCstruct | MC54520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.73 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0244- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q92VX9 | 7-80 | RAMSREEAADIYRRSYWPQCGVDLLPPGLDYAVFDFGVNSGPARAVKTLQKVVGVREDGHVGEQTLAAVRKFEG |
| Q2YQ86 | 16-93 | VSKAEVKALTKTKATDIYRENYWNKVAGDDLPAGVDHATLDFAIHSGPARAVKMLQKVVGVDQDGVIGAKTLAAVRKM |
| A0A1U7JJA6 | 238-313 | None |
| J5PRP4 | 1-76 | None |
| A0A853IHS9 | 47-123 | None |
| A0A3B0THL8 | 52-129 | None |
| A0A1N7LS44 | 97-168 | None |
| A0A1I5TV14 | 5-85 | None |
| A0A2W7CDZ9 | 190-251 | None |
| A0A327MK17 | 84-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.