DPCstruct | MC5452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 141 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832HW06 | 2-129 | AENQEREKVGLRTVKPTWHLYRVEFGAEDWKVQQNGWLAKRIQRDSKGNPQWEEDYYHSGKTYRTENGGQDWERITVHYDYGPGTLE… |
| A0A5B8W4T2 | 3-134 | YKDIAKYNNNVQLGKFGRVFNPTRRRLGVPEIPVDWYIKYKGNRFVEWQAKDTTIGHQSKYVSLEDAVWKIELEVDDYKLKPIDSVS… |
| A0A839NZ44 | 23-154 | None |
| A0A5B8V0E8 | 12-154 | None |
| A0A3C2A6Q7 | 44-200 | None |
| G8TGT0 | 36-192 | None |
| A0A7G8WCV2 | 5-162 | None |
| A0A1G0YQB3 | 1-121 | None |
| A0A1G0YPX9 | 11-166 | None |
| A0A7Y4R0J7 | 9-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.