DPCstruct | MC54516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.74 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0260- PF20965 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NHZ7 | 17-118 | QIERNDELGYVLDVKQMMLNYFAIRHAAWFSEMSRNMPQDFQQEYRALIRVLEDVRSRYKNFKPMPLWTLQYIAFYRLVHGPNRQKA… |
| A0A7J8CR92 | 26-148 | TMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTP… |
| A0A7T8KAW3 | 1-112 | None |
| W5MIW5 | 1-99 | None |
| A0A212FJE0 | 17-139 | None |
| A0A7J5XC93 | 36-147 | None |
| A0A0M3J8K0 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.