DPCstruct | MC54515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IZL8 | 3-147 | SIHTIPLLFLNLGGEMMYILDQRLQAQKIPKDKSMKVMNDITSIMLNEKFLGELFKPQEVYNKQALRKLFEDLAHGSIMRLNSASMD… |
| A0A183FP39 | 1-172 | MSLKCFPLLYVNMAGEMIYILEQRIKNQKNISEEKGDLVLHDIISQTLKQKYLHEIFKYPTLPTVTEIHMRAMFERLAHSSIMRLSE… |
| A0A226EM93 | 5-149 | None |
| A0A672KBX4 | 5-138 | None |
| A0A819SBP8 | 2-141 | None |
| A4HXK3 | 2-144 | None |
| B7PHA9 | 3-153 | None |
| A0A813S5L5 | 145-309 | None |
| A0A1Y1VJ29 | 3-173 | None |
| G1TSV5 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.