DPCstruct | MC54514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 265 ± 74 aa |
| Standard deviation of domain lengths | 74.38 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FJB2 | 2-273 | TEQPPQSDDPDVFKLKAIQFNSSKVSIVTQNLNGPCPLIALVNVLALKGLARLPASGHVTRDALTHLIADVLLQMRPDNMNSHVESN… |
| Q55D67 | 90-340 | PTENRYRVKRITYLKKEVSIILQNENGPCPLISIANVLLLSQKIYLDPDIQFVTIKKLGDLIMKHAKSLYKENQDVLEILEDYNKNV… |
| A0A4Y7J5Y9 | 40-468 | None |
| A0A7J0G886 | 2-244 | None |
| A0A0E0HVH7 | 126-364 | None |
| A0A368PZV4 | 2-144 | None |
| A0A7J6LSN2 | 285-633 | None |
| A0A1J3GG80 | 22-183 | None |
| H9GAN4 | 137-301 | None |
| A0A1I8IVI2 | 66-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.