DPCstruct | MC54511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 233 ± 67 aa |
| Standard deviation of domain lengths | 66.87 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.67 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0023- PF16521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FFF7 | 39-291 | EEEQRMAAAERERLDSTIASRLSRDGGGAMMDTPTTSMSSSSSTESSTKPKSKYNLSTWRYAELRDTINTSTDMELLLACKEEFHRR… |
| A0A1S3KD83 | 2-192 | AQRQAAAGKKFDLAKWKYAELRDAINTSCDVELLEACREEFHRRLKVYHAWKSKNKKRNVNERQTKQPESNEERAPQYVMEQAGNAP… |
| A0A0A9YEQ3 | 444-629 | None |
| A0A7R9J0E4 | 31-504 | None |
| A0A2J7PRN4 | 88-342 | None |
| A0A182G4M5 | 11-191 | None |
| A0A6S7HAZ3 | 229-462 | None |
| A0A212C5Z6 | 149-434 | None |
| A0A1D2MYR5 | 284-476 | None |
| J9BM25 | 1-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.