DPCstruct | MC5451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A252CVM6 | 1-100 | MWVFDDDKVGLVREPFVAGADKIIDRLVANIPNAEAGFNLLFSARPFPGYQAKFDWQREEYGGNWYYNAELNIEGWLCPALFKYFHE… |
| A0A5B8VWM2 | 1-114 | MPVTYKFIKEPTNRWYIDLPDWQGVHADLEMVEGADTMLDYVGQGAREVELQLAEEPFENATPLQLIEDYRDHVGGGIYLLAQYNGE… |
| A0A3S0DCD0 | 11-136 | None |
| A0A1G0ZM32 | 6-125 | None |
| A0A162CRJ9 | 30-151 | None |
| A0A2G2HY98 | 288-410 | None |
| A0A2E7TTU2 | 8-125 | None |
| A0A1M6SL71 | 22-142 | None |
| A0A4Q2WGG7 | 1-121 | None |
| A0A6P1VHI5 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.