DPCstruct | MC54505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0BU07 | 30-152 | AVVLKANESKITPLSATRDVIPEGRQIYQNLFSFTLNVAKPMEIAVYAPLFNPVLYESEFESQLWMIFDSNKAMIACGDANSHTFYT… |
| A0A1D6HFE1 | 126-239 | ECNLSSLPTDRDKLPSGKQIIALTLTYKFKLEDNAEIKPHVPLLNNRIYDNKFESQFYRISDSNKRIYSSGDVYPSYVRLSKGEYTL… |
| A0A0B2SB37 | 463-575 | None |
| A0A6H5GJE3 | 808-931 | None |
| A0A1A9X3J2 | 37-152 | None |
| A0A672SJJ0 | 473-594 | None |
| A0A822EX49 | 566-660 | None |
| A0A2G2X6T0 | 721-814 | None |
| A0A800MA05 | 30-147 | None |
| A0A7R9PW68 | 555-665 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.