DPCstruct | MC54504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183F7R1 | 1-114 | MQAICPSFHAELVPVVSNRLMNTPMSAALFEHFFVNYGLLSPVEYKDGSVMMRHRGNAFGILRQGRTRLNDFRLPFRAYPFIESPPS… |
| A0A5E4A7N1 | 157-331 | SSCNSHIRDLDVDISGDLRWLLKLFHDQIESKFRTMLETKICSMIDKSVTSDLQPYLQTLPVIAEIDSFAGVDYSLTEAPRATANML… |
| A0A4W3J5A4 | 4-141 | None |
| A0A2I0TNZ7 | 6-157 | None |
| S9XQI5 | 143-270 | None |
| A0A7J5Z276 | 1-161 | None |
| A0A2K6U464 | 1-162 | None |
| A0A402FV17 | 266-435 | None |
| A0A0C2C9X5 | 1-122 | None |
| A0A498NXA7 | 87-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.