DPCstruct | MC54503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 299 ± 71 aa |
| Standard deviation of domain lengths | 70.80 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7WW29 | 2-265 | AVETGLLPPRMVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQLLTAREVIAYILE… |
| A0A0N4YYI6 | 1-263 | MCVEGLALTADFTLRTIMDPQKWIFIEENIPLMDYKGVRSLFKCLIYQQFNSIPAQLSPEQRRQLLPSERILLKILDPDLNVIPPIF… |
| T1KIW4 | 8-266 | None |
| A0A1X7T1C2 | 3-384 | None |
| A0A7R9AQT1 | 3-282 | None |
| T1KM15 | 26-286 | None |
| A0A1B0BXH5 | 3-420 | None |
| A0A158R710 | 17-248 | None |
| A0A3S3SRA1 | 102-336 | None |
| A0A158PT19 | 12-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.