DPCstruct | MC54501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 367 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 81.75 |
| Assigned Pfam label(s) | CL0123- CL0229- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183F3M3 | 66-386 | FVQDQLLPYWLECAHCHKFRKLDLEPMVVITTDDVKNFRCTDCALPENKLAADARHSNWILSASVAPLLHNSPSLYYLRDHYYLDEV… |
| A0A4W4HJX3 | 1-375 | CFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYEKYSLWKRLWTGNGKSEPSVKAFMSDQQLPYWVQCTKPDCGKWR… |
| A0A0R3TSI4 | 2-383 | None |
| A0A5K3EIN8 | 19-390 | None |
| A0A5K3EIG6 | 19-386 | None |
| A0A1S3ISL1 | 317-708 | None |
| A0A3S1B194 | 275-591 | None |
| E3NFT4 | 65-447 | None |
| A0A0N4Y0V5 | 62-450 | None |
| A0A3B4D2A1 | 156-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.