DPCstruct | MC545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9L7Z1 | 46-115 | DPSRMNGAMPICHKGCALRVWLVITGPESGHLWEDGRADYTGLFPLLLKDGSRATFSSWYGEWLVDALQM |
| A0A448RJZ7 | 5-66 | HITGCLQICHIGHGATYLLVVNGEEYGNIWLDERADYGGIEPLLNEKGERVSFISWFTEWLD |
| A0A563EWR5 | 22-83 | None |
| A0A2P2GTF8 | 73-131 | None |
| A0A7J5DMZ6 | 16-74 | None |
| A0A8B3C2N7 | 1-57 | None |
| A0A5N8VGW0 | 1-69 | None |
| A0A1P8WH06 | 153-214 | None |
| A0A4U0S2C8 | 7-70 | None |
| A0A412S5V5 | 55-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.