DPCstruct | MC54489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 136 ± 24 aa |
| Standard deviation of domain lengths | 23.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.88 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | CL0023- CL0269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1DDQ4 | 1-81 | MGATGTGKSRLSVDLATHFRGEIINSNKMQVYNGLDIVTNKITRAKKQGVRHYLQGEIEPDSEFKAEDFCHKSIVYIEFFL |
| A0A1G1YL29 | 441-587 | SPTPKLIVILGPTATGKTKMAAKLAAKFNGEIVSADSRQIYQGLDIGTGKDLDDYVVKTKKPKSQKAKKQKIKYHLIDIVNPKHEFN… |
| A0A2T4XB38 | 13-146 | None |
| M5JNS6 | 6-118 | None |
| A0A1B0C7J1 | 5-117 | None |
| A0A154PPN5 | 24-162 | None |
| A0A396HE92 | 8-159 | None |
| A0A670IU23 | 22-164 | None |
| A9SYC6 | 140-280 | None |
| A0A5K1K0K4 | 27-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.