DPCstruct | MC54478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 553 |
|---|---|
| Mean domain length (aa) | 215 ± 31 aa |
| Standard deviation of domain lengths | 30.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.05 |
| Pfam Score | 95.74 |
| Assigned Pfam label(s) | PF16466- CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4EYW9 | 2-215 | IVARCSQNVDQGQFASYHATLRPWLWLLTRTSDCRIFQNLTIPQIIKQVFRDLGFSDFEDALSQTYREWEYCVQYRETSFDFVSRLM… |
| W4Q5R5 | 4-220 | IIKTLNVNRQTTSILENAYKIGYDLTENQIWTAHFSLPLNDPKVDKVKLLEYVEITDGDRYIGLFRVIPKKTIKNESTKEVTFQCEH… |
| A0A559U362 | 29-223 | None |
| T2RGR0 | 9-156 | None |
| D2MPH5 | 1-213 | None |
| A0A3N5QGQ8 | 82-307 | None |
| B1V2P7 | 2-207 | None |
| R6SRS7 | 16-286 | None |
| U2G3I2 | 20-236 | None |
| A0A1D2UEL7 | 2-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.